PDB entry 2qos

View 2qos on RCSB PDB site
Description: Crystal structure of complement protein C8 in complex with a peptide containing the C8 binding site on C8
Class: immune system
Keywords: Beta barrel, lipocalin, Cleavage on pair of basic residues, Complement alternate pathway, Complement pathway, Cytolysis, EGF-like domain, Glycoprotein, Immune response, Innate immunity, Membrane attack complex, Polymorphism, Secreted, IMMUNE SYSTEM
Deposited on 2007-07-20, released 2007-10-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.204
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement component C8 alpha chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07357 (0-10)
      • engineered (6)
  • Chain 'C':
    Compound: Complement component 8, gamma polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene: C8G
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14CU0 (0-172)
      • engineered (30)
    Domains in SCOPe 2.04: d2qosc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qosC (C:)
aspistiqpkanfdaqqfagtwllvavgsaarflqeqghraeattlhvapqgtamavstf
rkldgicwqvrqlygdtgvlgrfllqargargavhvvvaetdyqsfavlyleragqlsvk
lyarslpvsdsvlsgfeqrvqeahltedqifyfpkygfceaadqfhvldevrr