PDB entry 2qlx

View 2qlx on RCSB PDB site
Description: Crystal structure of rhamnose mutarotase RhaU of Rhizobium leguminosarum in complex with L-Rhamnose
Class: isomerase
Keywords: RhaU, mutarotase, Rhizobium leguminosarum. L-rhamnose, Carbohydrate metabolism, Isomerase, Rhamnose metabolism
Deposited on 2007-07-13, released 2008-12-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.138
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-rhamnose mutarotase
    Species: Rhizobium leguminosarum bv. trifolii [TaxId:386]
    Gene: rhaM, rhaU
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BSH1 (2-107)
      • expression tag (0-1)
    Domains in SCOPe 2.04: d2qlxa_
  • Chain 'B':
    Compound: L-rhamnose mutarotase
    Species: Rhizobium leguminosarum bv. trifolii [TaxId:386]
    Gene: rhaM, rhaU
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BSH1 (2-107)
      • expression tag (0-1)
    Domains in SCOPe 2.04: d2qlxb_
  • Heterogens: RM4, MG, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qlxA (A:)
gdmtlekhafkmqlnpgmeaeyrkrhdeiwpelvdllhqsgasdysihldretntlfgvl
trpkdhtmaslpdhpvmkkwwahmadimatnpdnspvqsdlvtlfhmp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qlxB (B:)
gdmtlekhafkmqlnpgmeaeyrkrhdeiwpelvdllhqsgasdysihldretntlfgvl
trpkdhtmaslpdhpvmkkwwahmadimatnpdnspvqsdlvtlfhmp