PDB entry 2qh0

View 2qh0 on RCSB PDB site
Description: Crystal structure of a glyoxalase from clostridium acetobutylicum
Class: lyase
Keywords: Glyoxalase, 11003p, clostridium acetobutylicum, PSI-2, NYSGXRC, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, LYASE
Deposited on 2007-06-29, released 2007-07-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.235
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoylglutathione lyase
    Species: Clostridium acetobutylicum [TaxId:1488]
    Gene: CA_C2192
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97H22 (3-129)
      • cloning artifact (1-2)
    Domains in SCOPe 2.06: d2qh0a1, d2qh0a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qh0A (A:)
    mslkvhhigyavknidsalkkfkrlgyveesevvrdevrkvyiqfvinggyrvelvapdg
    edspinktikkgstpyhicyevediqksieemsqigytlfkkaeiapaidnrkvaflfst
    digliellekeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qh0A (A:)
    slkvhhigyavknidsalkkfkrlgyveesevvrdevrkvyiqfvinggyrvelvapdge
    dspinktikkgstpyhicyevediqksieemsqigytlfkkaeiapaidnrkvaflfstd
    igliellek