PDB entry 2qfk

View 2qfk on RCSB PDB site
Description: X-ray Crystal Structure Analysis of the Binding Site in the Ferric and Oxyferrous Forms of the Recombinant Heme Dehaloperoxidase Cloned from Amphitrite ornata
Class: transport protein
Keywords: crystal structure of dehaloperoxidase, DHP, globin, heme protein, TRANSPORT PROTEIN
Deposited on 2007-06-27, released 2008-07-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.194
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata
    Gene: dhpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2qfka_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata
    Gene: dhpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2qfkb_
  • Heterogens: NH4, SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qfkA (A:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2qfkB (B:)
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk