PDB entry 2qdx

View 2qdx on RCSB PDB site
Description: P.Aeruginosa Fpr with FAD
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2007-06-21, released 2007-10-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.158
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin reductase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FPR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2qdxa1, d2qdxa2
  • Heterogens: SO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2qdxA (A:)
    snlytervlsvhhwndtlfsfkttrnpglrfktgqfvmiglevdgrplmraysiaspnye
    ehleffsikvpdgpltsrlqhlkegdelmvsrkptgtlvhddllpgkhlyllstgtgmap
    flsviqdpetyeryekvilvhgvrwvselayadfitkvlpeheyfgdqvkekliyyplvt
    repfrnqgrqtdlmrsgklfediglppmnpqddramicgspsmleetsavldsfglkisp
    rmgepgdylierafvek