PDB entry 2q9v

View 2q9v on RCSB PDB site
Description: Crystal structure of the C890S mutant of the 4th PDZ domain of human membrane associated guanylate kinase
Class: transferase
Keywords: pdz, membrane associated guanylate kinase, cys ser mutant, structural genomics consortium, sgc, transferase
Deposited on 2007-06-14, released 2007-06-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAGI1, BAIAP1, BAP1, TNRC19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96QZ7 (2-85)
      • cloning artifact (0-1)
      • engineered (53)
      • cloning artifact (86-89)
    Domains in SCOPe 2.04: d2q9va_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2q9vA (A:)
smeqdiflwrketgfgfrilggnepgepiyighivplgaadtdgrlrsgdelisvdgtpv
igkshqlvvqlmqqaakqghvnltvrqtrl