PDB entry 2q96

View 2q96 on RCSB PDB site
Description: E. coli methionine aminopeptidase Mn-form with inhibitor A18
Class: hydrolase
Keywords: aminopeptidase, hydrolase, dinuclear, Mn(II)-form, enzyme-inhibitor complex, metalloenzyme
Deposited on 2007-06-12, released 2008-01-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: map
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q96a_
  • Heterogens: MN, NA, A18, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q96A (A:)
    aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
    yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
    gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
    qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
    dngceiltlrkddtipaiishde