PDB entry 2q4y
View 2q4y on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of At1g77540-coenzyme A complex
Class: transferase
Keywords: Ensemble Refinement, Refinement Methodology Development, CoA, Coenzyme-A, COG2388 Family, acetyltransferase, At1g77540, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, TRANSFERASE
Deposited on
2007-05-31, released
2007-06-19
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-08-10, with a file datestamp of
2011-08-05.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.171
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Uncharacterized protein At1g77540
Species: Arabidopsis thaliana [TaxId:3702]
Gene: At1g77540, T5M16.13
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2q4ya_ - Heterogens: COA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2q4yA (A:)
mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
Sequence, based on observed residues (ATOM records): (download)
>2q4yA (A:)
ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
asshsisiipscsyvsdtflprnpswkplih