PDB entry 2q21

View 2q21 on RCSB PDB site
Description: crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp
Class: oncogene protein
Keywords: oncogene protein
Deposited on 1991-09-25, released 1992-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-07, with a file datestamp of 2012-03-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: c-h-ras p21 protein catalytic domain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (0-170)
    • engineered mutation (11)
  Domains in SCOPe 2.06: d2q21a_
• Heterogens: MG, GDP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q21A (A:)
  mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
  qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
  aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqhklrkl