PDB entry 2pz4

View 2pz4 on RCSB PDB site
Description: Crystal Structure of SpaB (GBS52), the minor pilin in gram-positive pathogen Streptococcus agalactiae
Class: cell adhesion
Keywords: GBS52, SpaB, Streptococcus agalactiae, gram-positive pilins, adhesions, IgG-like domain, CELL ADHESION
Deposited on 2007-05-17, released 2007-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein gbs052
    Species: STREPTOCOCCUS AGALACTIAE [TaxId:1311]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8E6E3 (2-238)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2pz4a1, d2pz4a2, d2pz4a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pz4A (A:)
    aahqltivhleardidrpnpqleiapkegtpiegvlyqlyqlkstedgdllahwnsltit
    elkkqaqqvfeattnqqgkatfnqlpdgiyyglavkageknrnvsaflvdlsedkviypk
    iiwstgeldllkvgvdgdtkkplagvvfelyekngrtpirvkngvhsqdidaakhletds
    sghirisglihgdyvlkeietqsgyqigqaetavtieksktvtvtienkkvptpkvpsr