![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) ![]() |
![]() | Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins) Pfam PF05738 |
![]() | Protein automated matches [310857] (1 species) not a true protein |
![]() | Species Streptococcus agalactiae [TaxId:1311] [311237] (1 PDB entry) |
![]() | Domain d2pz4a2: 2pz4 A:121-237 [304389] Other proteins in same PDB: d2pz4a3 automated match to d3phsa2 |
PDB Entry: 2pz4 (more details), 1.8 Å
SCOPe Domain Sequences for d2pz4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pz4a2 b.3.5.1 (A:121-237) automated matches {Streptococcus agalactiae [TaxId: 1311]} wstgeldllkvgvdgdtkkplagvvfelyekngrtpirvkngvhsqdidaakhletdssg hirisglihgdyvlkeietqsgyqigqaetavtieksktvtvtienkkvptpkvpsr
Timeline for d2pz4a2: