PDB entry 2pya

View 2pya on RCSB PDB site
Description: Ultra-high resolution structure of P. abyssi rubredoxin W4L/R5S/A44S
Class: electron transport
Keywords: O-H...S-Fe hydrogen bond, ELECTRON TRANSPORT
Deposited on 2007-05-16, released 2008-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.86 Å
R-factor: 0.098
AEROSPACI score: 1.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: rub
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9V099 (0-51)
      • engineered (2-3)
      • engineered (42)
    Domains in SCOPe 2.06: d2pyaa_
  • Heterogens: FE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pyaA (A:)
    aklsckicgyiydedegdpdngispgtkfedlpddwvcplcgspkseferie