PDB entry 2pwn

View 2pwn on RCSB PDB site
Description: Crystal structure of BET3 homolog (13277653) from Mus musculus at 2.04 A resolution
Class: transport protein
Keywords: 13277653, Transport protein particle (TRAPP) component, Bet3, BET3 homolog, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, TRANSPORT PROTEIN
Deposited on 2007-05-11, released 2007-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trafficking protein particle complex subunit 3
    Species: Mus musculus [TaxId:10090]
    Gene: 13277653, Trappc3, Bet3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O55013
      • modified residue (25)
      • modified residue (58)
      • modified residue (96)
      • modified residue (152)
      • modified residue (155)
      • modified residue (176)
    Domains in SCOPe 2.08: d2pwna_
  • Heterogens: MYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pwnA (A:)
    mgsdkihhhhhhmsrqanrgteskkmsselftltygalvtqlckdyendedvnkqldrmg
    ynigvrliedflarsnvgrchdfretadviakvafkmylgitpsitnwspagdefslile
    nnplvdfvelpdnhsaliysnllcgvlrgalemvqmaveakfvqdtlkgdgvteirmrfi
    rriednlpagee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pwnA (A:)
    kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdf
    retadviakvafkmylgitpsitnwspagdefslilennplvdfvnhsaliysnllcgvl
    rgalemvqmaveakfvqdtlkgdgvteirmrfirried