SCOPe 2.08: Domain d2pwna_: 2pwn A:

Lineage for d2pwna_ (2pwn A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families)

5. Family d.278.1.2: TRAPP components [118076] (3 proteins)
   Pfam PF04051; form homo- and hetero-dimers with the first two helices of one subunit complementing the fold of the other subunit to the H-NOX domain fold

6. Protein Trafficking protein particle complex subunit 3, Bet3 homolog [118077] (1 species)
   covalently linked long fatty acid occupies the ligand-binding cavity

7. Species Mouse (Mus musculus) [TaxId:10090] [118078] (3 PDB entries)
   Uniprot O55013 9-173

8. Domain d2pwna_: 2pwn A: [139764]
   automated match to d1wc8a_
   complexed with myr

Details for d2pwna_

PDB Entry: 2pwn, 2.04 Å

PDB Description: crystal structure of bet3 homolog (13277653) from mus musculus at 2.04 a resolution

PDB Compounds: (A:) Trafficking protein particle complex subunit 3

SCOPe Domain Sequences for d2pwna_:

Sequence, based on SEQRES records:

>d2pwna_ d.278.1.2 (A:) Trafficking protein particle complex subunit 3, Bet3 homolog {Mouse (Mus musculus) [TaxId: 10090]}
kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdf
retadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnll
cgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirried

Sequence, based on observed residues (ATOM records):

>d2pwna_ d.278.1.2 (A:) Trafficking protein particle complex subunit 3, Bet3 homolog {Mouse (Mus musculus) [TaxId: 10090]}
kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdf
retadviakvafkmylgitpsitnwspagdefslilennplvdfvnhsaliysnllcgvl
rgalemvqmaveakfvqdtlkgdgvteirmrfirried

Timeline for d2pwna_:

• d2pwna_ first appeared in SCOP 1.73, called d2pwna1
  
• d2pwna_ appears in SCOPe 2.07