PDB entry 2pvg

View 2pvg on RCSB PDB site
Description: Crystal srtucture of the binary complex between ferredoxin and ferredoxin:thioredoxin reductase
Class: electron transport
Keywords: Thioredoxin, ferredoxin. redox, iron-sulfur, ELECTRON TRANSPORT
Deposited on 2007-05-09, released 2007-07-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.238
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin-thioredoxin reductase, catalytic chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55389 (2-107)
      • cloning artifact (0-1)
      • conflict (104)
    Domains in SCOPe 2.04: d2pvga_
  • Chain 'B':
    Compound: Ferredoxin-thioredoxin reductase, variable chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55781 (0-72)
      • conflict (21)
      • conflict (40)
      • conflict (59)
    Domains in SCOPe 2.04: d2pvgb_
  • Chain 'C':
    Compound: Ferredoxin-1
    Species: Synechocystis sp. [TaxId:1143]
    Gene: petF, fed
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27320 (0-95)
      • conflict (33)
    Domains in SCOPe 2.04: d2pvgc_
  • Heterogens: FES, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvgA (A:)
    aatlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaev
    kntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleekkas
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvgB (B:)
    mnvgdrvrvtssvvvyhhpehaktafdlqgmegevaavltgwqgrpisanlpvlvkfeqa
    fkahfrpdevtli
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pvgC (C:)
    asytvklitpdgessiecsddtyildaaeeaglelpyscragacstcagkitagsvdqsd
    qsfldddqieagyvltcvayptsdctiethkeedly