PDB entry 2pvg
View 2pvg on RCSB PDB site
Description: Crystal srtucture of the binary complex between ferredoxin and ferredoxin:thioredoxin reductase
Class: electron transport
Keywords: Thioredoxin, ferredoxin. redox, iron-sulfur, ELECTRON TRANSPORT
Deposited on
2007-05-09, released
2007-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ferredoxin-thioredoxin reductase, catalytic chain
Species: Synechocystis sp. [TaxId:1143]
Gene: ftrC
Database cross-references and differences (RAF-indexed):
- Uniprot Q55389 (2-107)
- cloning artifact (0-1)
- conflict (104)
Domains in SCOPe 2.08: d2pvga1, d2pvga2 - Chain 'B':
Compound: Ferredoxin-thioredoxin reductase, variable chain
Species: Synechocystis sp. [TaxId:1143]
Gene: ftrV
Database cross-references and differences (RAF-indexed):
- Uniprot Q55781 (0-72)
- conflict (21)
- conflict (40)
- conflict (59)
Domains in SCOPe 2.08: d2pvgb_ - Chain 'C':
Compound: Ferredoxin-1
Species: Synechocystis sp. [TaxId:1143]
Gene: petF, fed
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2pvgc_ - Heterogens: SF4, FES, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2pvgA (A:)
aatlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaev
kntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleekkas
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2pvgB (B:)
mnvgdrvrvtssvvvyhhpehaktafdlqgmegevaavltgwqgrpisanlpvlvkfeqa
fkahfrpdevtli
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2pvgC (C:)
asytvklitpdgessiecsddtyildaaeeaglelpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly