Lineage for d2pvgc_ (2pvg C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933782Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2933890Species Synechocystis sp. [TaxId:1111708] [277072] (2 PDB entries)
  8. 2933892Domain d2pvgc_: 2pvg C: [167287]
    Other proteins in same PDB: d2pvga1, d2pvga2, d2pvgb_
    automated match to d1doxa_
    complexed with fes, sf4

Details for d2pvgc_

PDB Entry: 2pvg (more details), 2.4 Å

PDB Description: crystal srtucture of the binary complex between ferredoxin and ferredoxin:thioredoxin reductase
PDB Compounds: (C:) Ferredoxin-1

SCOPe Domain Sequences for d2pvgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pvgc_ d.15.4.1 (C:) 2Fe-2S ferredoxin {Synechocystis sp. [TaxId: 1111708]}
asytvklitpdgessiecsddtyildaaeeaglelpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly

SCOPe Domain Coordinates for d2pvgc_:

Click to download the PDB-style file with coordinates for d2pvgc_.
(The format of our PDB-style files is described here.)

Timeline for d2pvgc_: