PDB entry 2ppo

View 2ppo on RCSB PDB site
Description: Crystal structure of E60A mutant of FKBP12
Class: lyase
Keywords: high resolution protein structure, lyase
Deposited on 2007-04-30, released 2008-05-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP1A, FKBP1, FKBP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered (59)
    Domains in SCOPe 2.02: d2ppoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ppoA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwa
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle