PDB entry 2plt

View 2plt on RCSB PDB site
Description: structure determination of plastocyanin from a crystal specimen with hemihedral twinning fraction of one-half
Class: electron transport
Keywords: electron transport
Deposited on 1993-05-06, released 1993-10-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-07-18, with a file datestamp of 2012-07-13.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.168
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: plastocyanin
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P18068 (0-97)
  Domains in SCOPe 2.02: d2plta_
• Heterogens: CU, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pltA (A:)
  datvklgadsgalefvpktltiksgetvnfvnnagfphnivfdedaipsgvnadaisrdd
  ylnapgetysvkltaageygyycephqgagmvgkiivq