PDB entry 2pii

View 2pii on RCSB PDB site
Description: pii, glnb product
Class: signal transduction protein
Keywords: signal transduction protein
Deposited on 1995-05-02, released 1996-06-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.132
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pii
    Species: Escherichia coli [TaxId:562]
    Gene: GLNB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2piia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2piiA (A:)
mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai