PDB entry 2pd2
View 2pd2 on RCSB PDB site
Description: Crystal structure of (ST0148) conserved hypothetical from Sulfolobus Tokodaii Strain7
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on
2007-03-31, released
2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.186
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Hypothetical protein ST0148
Species: Sulfolobus tokodaii [TaxId:273063]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2pd2a_ - Chain 'B':
Compound: Hypothetical protein ST0148
Species: Sulfolobus tokodaii [TaxId:273063]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2pd2b_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2pd2A (A:)
mkvvvqikdfdkvpqalrsvinlyndikdaeievvlhqsaikallkdsdtrsiiedlikk
nilivgcensirsqnlshdqlipgikivtsgvgeivrkqsegwiylal
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2pd2B (B:)
mkvvvqikdfdkvpqalrsvinlyndikdaeievvlhqsaikallkdsdtrsiiedlikk
nilivgcensirsqnlshdqlipgikivtsgvgeivrkqsegwiylal