PDB entry 2pcq

View 2pcq on RCSB PDB site
Description: Crystal structure of putative dihydrodipicolinate synthase (TTHA0737) from Thermus Thermophilus HB8
Class: lyase
Keywords: Lyase, Lysine Biosynthesis, Synthase, Dihydrodipicoliante, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-30, released 2007-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative dihydrodipicolinate synthase
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SKB1 (0-282)
  Domains in SCOPe 2.06: d2pcqa_
• Heterogens: K, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pcqA (A:)
  milppiptpfdregrldeeafrelaqaleplvdgllvygsngegvhltpeerarglralr
  prkpflvglmeetlpqaegalleakaagamallatppryyhgslgagllryyealaekmp
  lflyhvpqntkvdlpleavealaphpnvlgikdssgdlsriafyqarlqefrvytghapt
  flgalalgaeggilaaanlaprayralldhfregrlaeaqelqkklfplgdllakggvpl
  lkqalrhlglpagyprppypaesplwerflpvleglkeegwvl