PDB entry 2p8i

View 2p8i on RCSB PDB site
Description: Crystal structure of putative dioxygenase (YP_555069.1) from Burkholderia xenovorans LB400 at 1.40 A resolution
Class: oxidoreductase
Keywords: YP_555069.1, putative dioxygenase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, OXIDOREDUCTASE
Deposited on 2007-03-22, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative dioxygenase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: YP_555069.1, Bxeno_B2751, Bxe_B0224
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13JM0 (1-116)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (56)
    Domains in SCOPe 2.07: d2p8ia2, d2p8ia3
  • Chain 'B':
    Compound: Putative dioxygenase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: YP_555069.1, Bxeno_B2751, Bxe_B0224
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13JM0 (1-116)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (56)
    Domains in SCOPe 2.07: d2p8ib2, d2p8ib3
  • Chain 'C':
    Compound: Putative dioxygenase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: YP_555069.1, Bxeno_B2751, Bxe_B0224
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13JM0 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (56)
    Domains in SCOPe 2.07: d2p8ic2, d2p8ic3
  • Chain 'D':
    Compound: Putative dioxygenase
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: YP_555069.1, Bxeno_B2751, Bxe_B0224
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13JM0 (1-116)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (56)
    Domains in SCOPe 2.07: d2p8id2, d2p8id3
  • Heterogens: CL, PO4, EDO, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2p8iA (A:)
gmtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsy
qlaftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsaln

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2p8iB (B:)
gmtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsy
qlaftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsaln

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2p8iC (C:)
gmtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsy
qlaftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsaln

    Sequence, based on observed residues (ATOM records): (download) 
    >2p8iC (C:)
gmtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsy
qlaftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsal

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2p8iD (D:)
gmtfrdtsaiaswhahvyfdassrdaawtlreqieahwsgklqlgrfherpvgphpmwsy
qlaftqeqfadlvgwltlnhgaldiflhpntgdalrdhrdaavwighshelvlsaln