SCOPe 2.07: Structural Classification of Proteins

PDB entry 2p3r

View 2p3r on RCSB PDB site
Description: Crystal structure of a hyperactive Escherichia coli glycerol kinase mutant Gly230->Asp obtained using microfluidic crystallization devices
Class: transferase
Keywords: glycerol kinase, glycerol metabolism, allosteric regulation, microfluidics, crystal structure, TRANSFERASE
Deposited on 2007-03-09, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-11-04, with a file datestamp of 2008-10-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: glycerol kinase
Species: Escherichia coli K12 [TaxId:83333]
Gene: GLPK
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6F3 (0-498)
  - engineered (228)
Domains in SCOPe 2.07: d2p3ra3, d2p3ra4
Chain 'B':
Compound: glycerol kinase
Species: Escherichia coli K12 [TaxId:83333]
Gene: GLPK
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6F3 (0-498)
  - engineered (228)
  - cloning artifact (499-507)
Domains in SCOPe 2.07: d2p3rb3, d2p3rb4, d2p3rb5
Chain 'C':
Compound: glycerol kinase
Species: Escherichia coli K12 [TaxId:83333]
Gene: GLPK
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6F3 (0-498)
  - engineered (228)
Domains in SCOPe 2.07: d2p3rc3, d2p3rc4
Chain 'D':
Compound: glycerol kinase
Species: Escherichia coli K12 [TaxId:83333]
Gene: GLPK
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6F3 (0-498)
  - engineered (228)
Domains in SCOPe 2.07: d2p3rd3, d2p3rd4
Chain 'E':
Compound: glycerol kinase
Species: Escherichia coli K12 [TaxId:83333]
Gene: GLPK
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6F3 (0-498)
  - engineered (228)
Domains in SCOPe 2.07: d2p3re3, d2p3re4
Chain 'F':
Compound: glycerol kinase
Species: Escherichia coli K12 [TaxId:83333]
Gene: GLPK
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6F3 (0-498)
  - engineered (228)
Chain 'G':
Compound: glycerol kinase
Species: Escherichia coli K12 [TaxId:83333]
Gene: GLPK
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6F3 (0-498)
  - engineered (228)
  - cloning artifact (499-509)
Domains in SCOPe 2.07: d2p3rg3, d2p3rg4, d2p3rg5
Chain 'H':
Compound: glycerol kinase
Species: Escherichia coli K12 [TaxId:83333]
Gene: GLPK
Database cross-references and differences (RAF-indexed):
- Uniprot P0A6F3 (0-498)
  - engineered (228)
Heterogens: GOL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2p3rA (A:)
ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlv
evlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtnidgkggtripisg
iagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnya
legavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyar
gaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqf
qsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgietterny
ryagwkkavkramaweehdqlytrasqpel