PDB entry 2p2e
View 2p2e on RCSB PDB site
Description: Crystal structure of a putative Fe-S biosynthesis protein from Lactobacillus salivarius with novel protein fold
Class: structural genomics, unknown function
Keywords: hypothetical protein, beta-barrel, Fe-S biosynthesis, 10399l, Structural Genomics, Protein Structure Initiative, PSI-2, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on
2007-03-07, released
2007-03-20
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: 0.229
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Putative Fe-S biosynthesis protein
Species: Lactobacillus salivarius [TaxId:362948]
Gene: LSL_1730
Database cross-references and differences (RAF-indexed):
- Uniprot Q1WRG6 (3-119)
- cloning artifact (2)
- modified residue (57)
- modified residue (82)
- modified residue (84)
- modified residue (88)
- modified residue (110)
- cloning artifact (120)
Domains in SCOPe 2.06: d2p2ea1, d2p2ea2, d2p2ea3 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2p2eA (A:)
mslkitvtddaakklqrytddsnavllldfddgvgalskvgvcslnsdfrilvvskdmdy
kkdynevidsnigkfyykgyskmymddnmkislntnnsllrltgdnsgelmpalsiqdfr
eghhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2p2eA (A:)
lkitvtddaakklqrytddsnavllldfddgvgalskvgvcslnsdfrilvvskdmdykk
dynevidsnigkfyykgyskmymddnmkislntnnsllrltgdnsgelmpalsiqdfre