PDB entry 2ozf

View 2ozf on RCSB PDB site
Description: The crystal structure of the 2nd PDZ domain of the human NHERF-1 (SLC9A3R1)
Class: protein binding
Keywords: PDZ domain, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN BINDING
Deposited on 2007-02-26, released 2007-03-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.172
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ezrin-radixin-moesin-binding phosphoprotein 50
    Species: Homo sapiens [TaxId:9606]
    Gene: SLC9A3R1, NHERF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14745 (2-87)
      • cloning artifact (0-1)
      • cloning artifact (88-91)
    Domains in SCOPe 2.02: d2ozfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ozfA (A:)
    smlrprlctmkkgpsgygfnlhsdkskpgqfirsvdpdspaeasglraqdrivevngvcm
    egkqhgdvvsairaggdetkllvvdretetsl