PDB entry 2oxv
View 2oxv on RCSB PDB site
Description: Structure of the A138T promiscuous mutant of the EcoRI restriction endonuclease bound to its cognate recognition site.
Class: hydrolase/DNA
Keywords: EcoRI, type II restriction endonuclease, protein-DNA interactions, promiscuous mutant, relaxed specificity mutant, hydrolase-DNA COMPLEX
Deposited on
2007-02-21, released
2007-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Type II restriction enzyme EcoRI
Species: Escherichia coli [TaxId:562]
Gene: ecoRIR
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2oxva_ - Chain 'C':
Compound: DNA (5'-d(*tp*cp*gp*cp*gp*ap*ap*tp*tp*cp*gp*cp*g)-3')
Species: synthetic, synthetic
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2oxvA (A:)
msnkkqsnrlteqhklsqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrds
ikkteinealkkidpdlggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdii
nirngllvgkrgdqdlmtagnaiershkniseianfmlseshfpyvlflegsnfltenis
itrpdgrvvnleynsgilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytq
gdgrewdskimfeimfdisttslrvlgrdlfeqltsk
Sequence, based on observed residues (ATOM records): (download)
>2oxvA (A:)
sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
mtagnaiershkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
disttslrvlgrdlfeqltsk
- Chain 'C':
No sequence available.