PDB entry 2owf

View 2owf on RCSB PDB site
Description: Crystal structure of PH0725 from Pyrococcus horikoshii OT3
Class: Transferase
Keywords: Pyrococcus horikoshii OT3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
Deposited on 2007-02-16, released 2007-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphthine synthase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58456 (0-264)
      • engineered (142)
    Domains in SCOPe 2.07: d2owfa_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2owfA (A:)
    mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
    edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
    gitglhiykfgksatvaypegnmfptsyydvikenaerglhtllfldikaekrmymtane
    amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
    klhiveaeylveiagapreilrvnv