PDB entry 2ovo

View 2ovo on RCSB PDB site
Description: the crystal and molecular structure of the third domain of silver pheasant ovomucoid (omsvp3)
Deposited on 1985-06-11, released 1985-11-08
The last revision prior to the SCOP 1.59 freeze date was dated 1985-11-08, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.199
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d2ovo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ovo_ (-)
    laavsvdcseypkpactmeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc