PDB entry 2otr

View 2otr on RCSB PDB site
Description: Solution Structure of Conserved Hypothetical Protein HP0892 from Helicobacter pylori
Class: structural genomics, unknown function
Keywords: anti-parallel beta sheet, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2007-02-09, released 2007-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein HP0892
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2otra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2otrA (A:)
    mltietskkfdkdlkilvkngfdlkllykvvgnlateqplapkykdhplkgglkdfrech
    lkpdlllvyqikkqentlflvrlgshselflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2otrA (A:)
    mltietskkfdkdlkilvkngfdlkllykvvgnlateqplapkykdhplkgglkdfrech
    lkpdlllvyqikkqentlflvrlgshself