PDB entry 2opg

View 2opg on RCSB PDB site
Description: The crystal structure of the 10th PDZ domain of MPDZ
Class: structural protein
Keywords: Structural Protein, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-01-29, released 2007-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.175
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Multiple PDZ domain protein
  Species: Homo sapiens [TaxId:9606]
  Gene: MPDZ, MUPP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75970 (2-93)
    • cloning artifact (0-1)
    • cloning artifact (94-97)
  Domains in SCOPe 2.06: d2opga1, d2opga2, d2opga3
• Chain 'B':
  Compound: Multiple PDZ domain protein
  Species: Homo sapiens [TaxId:9606]
  Gene: MPDZ, MUPP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75970 (2-93)
    • cloning artifact (0-1)
    • cloning artifact (94-97)
  Domains in SCOPe 2.06: d2opgb1, d2opgb2, d2opgb3
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2opgA (A:)
  smgcettieiskgrtglglsivggsdtllgaiiihevyeegaackdgrlwagdqilevng
  idlrkathdeainvlrqtpqrvrltlyrdeapykstrl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2opgB (B:)
  smgcettieiskgrtglglsivggsdtllgaiiihevyeegaackdgrlwagdqilevng
  idlrkathdeainvlrqtpqrvrltlyrdeapykstrl