PDB entry 2ont

View 2ont on RCSB PDB site
Description: A swapped dimer of the HIV-1 capsid C-terminal domain
Class: viral protein
Keywords: HIV; capsid; GAG; domain swap, VIRAL PROTEIN
Deposited on 2007-01-24, released 2007-02-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.246
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE) [TaxId:11698]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2onta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ontA (A:)
    gsptsildirqgpkepfrdyvdrfyktlraeqsqevknwmtetllvqnanpdcktilkal
    gpgatleemmtacqgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ontA (A:)
    tsildirqgpkepfrdyvdrfyktlraeqsqevknwmtetllvqnanpdcktilkalgpg
    atleemmtacqgv