PDB entry 2omw

View 2omw on RCSB PDB site
Description: Crystal structure of InlA S192N Y369S/mEC1 complex
Class: cell invasion/cell adhesion
Keywords: leucine-rich-repeat, invasion protein, IG-like domain, adhesion protein, CELL INVASION-CELL ADHESION COMPLEX
Deposited on 2007-01-23, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Internalin-A
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: inlA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25146 (0-460)
      • engineered (156)
      • engineered (333)
    Domains in SCOPe 2.07: d2omwa1, d2omwa2
  • Chain 'B':
    Compound: epithelial-cadherin
    Species: Mus musculus [TaxId:10090]
    Gene: Cdh1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09803 (5-103)
      • cloning artifact (0-4)
      • engineered (89)
      • cloning artifact (104)
    Domains in SCOPe 2.07: d2omwb1, d2omwb2, d2omwb3
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omwA (A:)
    atitqdtpinqiftdtalaekmktvlgktnvtdtvsqtdldqvttlqadrlgiksidgve
    ylnnltqinfsnnqltditplknltklvdilmnnnqiaditplanltnltgltlfnnqit
    didplknltnlnrlelssntisdisalsgltslqqlnfgnqvtdlkplanlttlerldis
    snkvsdisvlakltnlesliatnnqisditplgiltnldelslngnqlkdigtlasltnl
    tdldlannqisnlaplsgltkltelklganqisnisplagltaltnlelnenqledispi
    snlknltyltlyfnnisdispvssltklqrlffsnnkvsdvsslanltninwlsaghnqi
    sdltplanltritqlglndqawtnapvnykanvsipntvknvtgaliapatisdggsyte
    pditwnlpsytnevsytfsqpvtigkgtttfsgtvtqplka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2omwB (B:)
    gplgswvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiiere
    tgwlkvtqpldreaiakyilyshavssngnavedpmeivitvtda