Lineage for d2omwb1 (2omw B:2-100)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. Domain d2omwb1: 2omw B:2-100 [145724]
    Other proteins in same PDB: d2omwa1, d2omwa2, d2omwb2, d2omwb3
    complexed with cl

Details for d2omwb1

PDB Entry: 2omw (more details), 1.85 Å

PDB Description: crystal structure of inla s192n y369s/mec1 complex
PDB Compounds: (B:) epithelial-cadherin

SCOPe Domain Sequences for d2omwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omwb1 b.1.6.1 (B:2-100) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
wvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlk
vtqpldreaiakyilyshavssngnavedpmeivitvtd

SCOPe Domain Coordinates for d2omwb1 are not available.

Timeline for d2omwb1:

Domains from same chain:
(mouse over for more information)
d2omwb2, d2omwb3
Domains from other chains:
(mouse over for more information)
d2omwa1, d2omwa2