PDB entry 2omj

View 2omj on RCSB PDB site
Description: solution structure of LARG PDZ domain
Class: cell adhesion
Keywords: nerve system development, actin reorganization, cell adhesion
Deposited on 2007-01-22, released 2008-01-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Rho guanine nucleotide exchange factor 12
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NZN5 (4-88)
    • expression tag (0-3)
  Domains in SCOPe 2.04: d2omja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2omjA (A:)
  gshmglvqrcviiqkddngfgltvsgdnpvfvqsvkedgaamragvqtgdriikvngtlv
  thsnhlevvkliksgsyvaltvqgrppgs