PDB entry 2ogp

View 2ogp on RCSB PDB site
Description: Solution structure of the second PDZ domain of Par-3
Class: signaling protein
Keywords: cell polarity, Par-3, PDZ domain, SIGNALING PROTEIN
Deposited on 2007-01-07, released 2007-12-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Partitioning-defective 3 homolog
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Z340 (0-96)
  Domains in SCOPe 2.04: d2ogpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ogpA (A:)
  krvgkrlniqlkkgteglgfsitsrdvtiggsapiyvknilprgaaiqdgrlkagdrlie
  vngvdlagksqeevvsllrstkmegtvsllvfrqeea