PDB entry 2odc

View 2odc on RCSB PDB site
Description: LEM-domain of the nuclear envelope protein emerin
Class: membrane protein
Keywords: inner nuclear membrane protein, lem-domain multidimensional nmr dipolar couplings
Deposited on 2006-12-22, released 2007-03-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'I':
  Compound: emerin
  Species: Homo sapiens [TaxId:9606]
  Gene: EMD, EDMD, STA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P50402 (1-46)
    • cloning artifact (0)
  Domains in SCOPe 2.05: d2odci_

PDB Chain Sequences:

• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2odcI (I:)
  hdnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr