Lineage for d2odci_ (2odc I:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751447Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 1751448Superfamily a.140.1: LEM domain [63451] (1 family) (S)
  5. 1751449Family a.140.1.1: LEM domain [63452] (2 proteins)
  6. 1751450Protein Inner nuclear membrane protein emerin [63455] (1 species)
  7. 1751451Species Human (Homo sapiens) [TaxId:9606] [63456] (3 PDB entries)
  8. 1751453Domain d2odci_: 2odc I: [139026]
    automated match to d1jeia_

Details for d2odci_

PDB Entry: 2odc (more details)

PDB Description: lem-domain of the nuclear envelope protein emerin
PDB Compounds: (I:) emerin

SCOPe Domain Sequences for d2odci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2odci_ a.140.1.1 (I:) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}
hdnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqrrr

SCOPe Domain Coordinates for d2odci_:

Click to download the PDB-style file with coordinates for d2odci_.
(The format of our PDB-style files is described here.)

Timeline for d2odci_: