PDB entry 2od5

View 2od5 on RCSB PDB site
Description: crystal structure of a putative nucleic acid binding protein (jcvi_pep_1096688149193) from uncultured marine organism at 1.79 a resolution
Class: DNA binding protein
Keywords: metagenomics, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi-2, DNA binding protein
Deposited on 2006-12-21, released 2007-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein
  Species: uncultured marine organism, synthetic [TaxId:360281]
  Database cross-references and differences (RAF-indexed):
  • PDB 2OD5
  Domains in SCOPe 2.08: d2od5a1
• Heterogens: CL, IMD, EDO, 1PE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2od5A (A:)
  gmtgavetesmktvrirekikkflgdrprntaeilehinstmrhgttsqqlgnvlskdkd
  ivkvgyikrsgilsggydicewatrnwvaehcpewtegqpiilneegdftlgplpe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2od5A (A:)
  etesmktvrirekikkflgdrprntaeilehinstmrhgttsqqlgnvlskdkdivkvgy
  ikrsgilsggydicewatrnwvaehcpewte