| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.70: Marine metagenome family WH1 [158296] (1 protein) |
| Protein Hypothetical protein GOS_3836187 [158297] (1 species) |
| Species Environmental samples [TaxId:33858] [158298] (1 PDB entry) marine metagenome |
| Domain d2od5a1: 2od5 A:6-96 [148736] complexed with 1pe, cl, edo, imd |
PDB Entry: 2od5 (more details), 1.79 Å
SCOPe Domain Sequences for d2od5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2od5a1 a.4.5.70 (A:6-96) Hypothetical protein GOS_3836187 {Environmental samples [TaxId: 33858]}
etesmktvrirekikkflgdrprntaeilehinstmrhgttsqqlgnvlskdkdivkvgy
ikrsgilsggydicewatrnwvaehcpewte
Timeline for d2od5a1: