PDB entry 2ob1

View 2ob1 on RCSB PDB site
Description: ppm1 with 1,8-ANS
Class: transferase
Keywords: ppm1 in the presence of 1,8-ANS, TRANSFERASE
Deposited on 2006-12-18, released 2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucine carboxyl methyltransferase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ob1a_
  • Chain 'B':
    Compound: Leucine carboxyl methyltransferase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ob1b_
  • Chain 'C':
    Compound: Leucine carboxyl methyltransferase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PPM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ob1c_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ob1A (A:)
    ydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkvdkamrs
    sfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphlayvdidy
    nesvelknsilreseilrislglskedtakspflidqgryklaacdlnditettrlldvc
    tkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrfgaimqs
    nlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlrslqfld
    eleelkvmqthyilmkaqw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ob1B (B:)
    ydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkvdkamrs
    sfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphlayvdidy
    nesvelknsilreseilrislglskedtakspflidqgryklaacdlnditettrlldvc
    tkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrfgaimqs
    nlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlrslqfld
    eleelkvmqthyilmkaqw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ob1C (C:)
    ydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkvdkamrs
    sfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphlayvdidy
    nesvelknsilreseilrislglskedtakspflidqgryklaacdlnditettrlldvc
    tkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrfgaimqs
    nlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlrslqfld
    eleelkvmqthyilmkaqw