Lineage for d2ob1a_ (2ob1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130217Family c.66.1.37: Leucine carboxy methyltransferase Ppm1 [102569] (1 protein)
  6. 2130218Protein Leucine carboxy methyltransferase Ppm1 [102570] (1 species)
    involved in the regulation of protein phosphatase 2a activity
  7. 2130219Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102571] (6 PDB entries)
  8. 2130223Domain d2ob1a_: 2ob1 A: [166614]
    automated match to d1rjda_
    complexed with po4

Details for d2ob1a_

PDB Entry: 2ob1 (more details), 1.9 Å

PDB Description: ppm1 with 1,8-ANS
PDB Compounds: (A:) Leucine carboxyl methyltransferase 1

SCOPe Domain Sequences for d2ob1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ob1a_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkvdkamrs
sfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphlayvdidy
nesvelknsilreseilrislglskedtakspflidqgryklaacdlnditettrlldvc
tkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrfgaimqs
nlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlrslqfld
eleelkvmqthyilmkaqw

SCOPe Domain Coordinates for d2ob1a_:

Click to download the PDB-style file with coordinates for d2ob1a_.
(The format of our PDB-style files is described here.)

Timeline for d2ob1a_: