PDB entry 2nwm

View 2nwm on RCSB PDB site
Description: Solution structure of the first SH3 domain of human Vinexin and its interaction with the peptides from Vinculin
Class: cell adhesion
Keywords: Vinexin SH3 domain, CELL ADHESION
Deposited on 2006-11-15, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vinexin
    Species: Homo sapiens [TaxId:9606]
    Gene: Vinexin
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60504 (1-56)
      • initiating methionine (0)
      • cloning artifact (57-58)
    Domains in SCOPe 2.07: d2nwma1, d2nwma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2nwmA (A:)
mkaarlkfdfqaqspkeltlqkgdivyihkevdknwlegehhgrlgifpanyvevlpleh
hhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2nwmA (A:)
mkaarlkfdfqaqspkeltlqkgdivyihkevdknwlegehhgrlgifpanyvevlple