PDB entry 2nqd

View 2nqd on RCSB PDB site
Description: Crystal structure of cysteine protease inhibitor, chagasin, in complex with human cathepsin L
Class: hydrolase inhibitor/hydrolase
Keywords: chagasin-cathepsin L complex, three prong inhibition mode, HYDROLASE INHIBITOR-HYDROLASE COMPLEX
Deposited on 2006-10-31, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chagasin
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nqda_
  • Chain 'B':
    Compound: Cathepsin L
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07711 (1-220)
      • engineered (25)
    Domains in SCOPe 2.07: d2nqdb_
  • Heterogens: NA, NDG, NAG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nqdA (A:)
shkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppd
skllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nqdB (B:)
eaprsvdwrekgyvtpvknqgqcgsawafsatgalegqmfrktgrlislseqnlvdcsgp
qgnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqe
kalmkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdn
nkywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv