PDB entry 2nnr

View 2nnr on RCSB PDB site
Description: Crystal structure of chagasin, cysteine protease inhibitor from Trypanosoma cruzi
Class: hydrolase inhibitor
Keywords: chagasin, deformed jelly roll, predominately beta structure, HYDROLASE INHIBITOR
Deposited on 2006-10-24, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chagasin
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nnra_
  • Chain 'B':
    Compound: Chagasin
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2nnrb_
  • Heterogens: SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nnrA (A:)
mshkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfpp
dskllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nnrB (B:)
mshkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfpp
dskllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan