PDB entry 2nnq

View 2nnq on RCSB PDB site
Description: Crystal structure of human adipocyte fatty acid binding protein in complex with ((2'-(5-ethyl-3,4-diphenyl-1H-pyrazol-1-yl)-3-biphenylyl)oxy)acetic acid
Class: lipid transport
Keywords: transport, lipid-binding, lipid transport
Deposited on 2006-10-24, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, adipocyte
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2nnqa_
  • Heterogens: SO4, T4B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2nnqA (A:)
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfknt
eisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmk
gvtstrvyera