Lineage for d2nnqa_ (2nnq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2804863Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 2804864Species Human (Homo sapiens) [TaxId:9606] [110275] (37 PDB entries)
    Uniprot P15090
  8. 2804897Domain d2nnqa_: 2nnq A: [138399]
    automated match to d1toua_
    complexed with so4, t4b

Details for d2nnqa_

PDB Entry: 2nnq (more details), 1.8 Å

PDB Description: crystal structure of human adipocyte fatty acid binding protein in complex with ((2'-(5-ethyl-3,4-diphenyl-1h-pyrazol-1-yl)-3- biphenylyl)oxy)acetic acid
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d2nnqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nnqa_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfknt
eisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmk
gvtstrvyera

SCOPe Domain Coordinates for d2nnqa_:

Click to download the PDB-style file with coordinates for d2nnqa_.
(The format of our PDB-style files is described here.)

Timeline for d2nnqa_: