PDB entry 2n8g

View 2n8g on RCSB PDB site
Description: NMR Structure of the homeodomain transcription factor Gbx1[E23R,R58E] from Homo sapiens
Class: DNA binding protein
Keywords: Homeodomain, DNA binding protein, Mutant, PSI-Biology
Deposited on 2015-10-15, released 2015-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-28, with a file datestamp of 2015-10-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein GBX-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GBX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14549 (1-70)
      • expression tag (0)
      • engineered mutation (22)
      • engineered mutation (57)
    Domains in SCOPe 2.07: d2n8ga1, d2n8ga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2n8gA (A:)
    gapggksrrrrtaftseqllelrkefhckkylsltersqiahalklsevqvkiwfqnera
    kwkrikagnvs