PDB entry 2myo

View 2myo on RCSB PDB site
Description: solution structure of myotrophin, nmr, minimized average structure
Class: ank-repeat
Keywords: myotrophin, acetylation, nmr, ank-repeat
Deposited on 1998-08-17, released 1999-08-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: myotrophin
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62775 (1-117)
  Domains in SCOPe 2.04: d2myoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2myoA (A:)
  mcdkefmwalkngdldevkdyvakgedvnrtleggrkplhyaadcgqleileflllkgad
  inapdkhhitpllsavyeghvscvklllskgadktvkgpdgltaleatdnqaikallq