PDB entry 2mxo

View 2mxo on RCSB PDB site
Description: NMR structure of spider toxin- G7W/N24S mutant of TRTX-Hhn2b
Class: toxin
Keywords: Spider toxin, Voltage gated ion channel, NaV1.7, TOXIN
Deposited on 2015-01-08, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mu-theraphotoxin-Hhn2b
    Species: Haplopelma hainanum [TaxId:209901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D2Y1X8 (1-33)
      • expression tag (0)
      • engineered mutation (6)
      • engineered mutation (23)
    Domains in SCOPe 2.07: d2mxoa1, d2mxoa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mxoA (A:)
    aeckgfwkscvpgkneccsgyacssrdkwckvll